Visit Us On FacebookVisit Us On Youtube

vodafone kündigung erfahrungen

} "action" : "rerender" "actions" : [ } LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ // console.log('watching: ' + key); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "context" : "", LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ;(function($) { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/21837","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pHDHBCCjTMYaaVzpvITzM6Hx1_lmA0G293MSCmttyoo. "actions" : [ "context" : "", if ( key == neededkeys[0] ) { "disableLinks" : "false", }, }, LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "action" : "rerender" { { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_Mobilfunk/thread-id/21837","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BkyuE86U4mjdSP3lpGH0XxkSrKckB3I2oR-tvNzFn6M. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" { }, { "context" : "", { { "kudosable" : "true", ] } "linkDisabled" : "false" { "}); "context" : "envParam:feedbackData", "disallowZeroCount" : "false", Erfahrungen mit Vodafone (110) ... Vorsicht bei Zusatzkarten und Tarif-Kündigung: Ich habe nach ca. }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "AcceptSolutionAction", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":88661,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/21837","ajaxErrorEventName":"LITHIUM:ajaxError","token":"54st0UHAqUW36Ilz5oR0RZmUhQplt8V8DzB5SfaK-WU. { Bist du sicher, dass du fortfahren möchtest? ] clearWarning(pagerId); Tipp: Hast du etwa eine Woche nach deiner Kündigung noch keine Bestätigung erhalten, solltest du mit Vodafone Kontakt aufnehmen und nachfragen, ob deine Kündigung angekommen ist. { "event" : "expandMessage", "action" : "rerender" "actions" : [ }, if ( neededkeys[count] == key ) { { { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", $(document).ready(function(){ { "event" : "RevokeSolutionAction", ] "context" : "", "actions" : [ "event" : "markAsSpamWithoutRedirect", "actions" : [ "event" : "MessagesWidgetEditCommentForm", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { "useSubjectIcons" : "true", { "message" : "88661", ] { document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); "actions" : [ Bist du sicher, dass du fortfahren möchtest? "linkDisabled" : "false" "actions" : [ }, { { ;(function($) { "initiatorBinding" : true, "disallowZeroCount" : "false", { }, "actions" : [ ] "context" : "envParam:quiltName,expandedQuiltName", { }, { "event" : "removeThreadUserEmailSubscription", "event" : "ProductAnswerComment", "actions" : [ "displaySubject" : "true", "initiatorBinding" : true, { { "actions" : [ ] "event" : "kudoEntity", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ] $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); { { "disallowZeroCount" : "false", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "context" : "", if ( count == neededkeys.length ) { "action" : "rerender" "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } ] "actions" : [ "event" : "addThreadUserEmailSubscription", { { "action" : "rerender" ;(function($) { } ] "componentId" : "forums.widget.message-view", "action" : "rerender" { "event" : "ProductMessageEdit", { }); "actions" : [ "action" : "rerender" }, "event" : "QuickReply", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'QM8-naRjHvND2S2pPBqEAyJBmr6wHRxix8EBB0bpDug. "parameters" : { }, "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); }, { "action" : "rerender" }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":88660,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "parameters" : { "action" : "rerender" { { }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-88662 .lia-rating-control-passive', '#form_6'); }, $(this).toggleClass("view-btn-open view-btn-close"); { "context" : "", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; } "event" : "ProductMessageEdit", })(LITHIUM.jQuery); } LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { } "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":88657,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "displaySubject" : "true", { "context" : "envParam:quiltName,message", "initiatorDataMatcher" : "data-lia-message-uid" Vodafone hat den Vertrag Eigenmächtig um 1 Jahr verlängert. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, { { "truncateBody" : "true", { { }, }); "componentId" : "kudos.widget.button", LITHIUM.Dialog.options['1427003629'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "MessagesWidgetEditAction", } }, } "actions" : [ { } "kudosLinksDisabled" : "false", "useSimpleView" : "false", "; Business Insider hat die auffälligsten Geschichten herausgegriffen und Vodafone um Stellungnahme gebeten. "actions" : [ { Die obige aboalarm Kündigungsvorlage ist von Anwälten geprüft und benötigt nur noch deine persönlichen Vertragsdaten. }, ], { "disallowZeroCount" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "actions" : [ } } ] { ;(function($) { "actions" : [ { "event" : "AcceptSolutionAction", "context" : "", } "actions" : [ "event" : "editProductMessage", "action" : "rerender" { { ', 'ajax'); } LITHIUM.AjaxSupport.ComponentEvents.set({ ], }, } "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, } else { "context" : "", "parameters" : { "event" : "MessagesWidgetEditAction", } { }, ', 'ajax'); }, "actions" : [ { "context" : "", }, })(LITHIUM.jQuery); "actions" : [ } "action" : "rerender" "context" : "envParam:feedbackData", // console.log('watching: ' + key); { "eventActions" : [ { } "action" : "rerender" ] var cookieDomain = 'forum.vodafone.de'; } { { "event" : "approveMessage", { "event" : "ProductMessageEdit", { { }, "actions" : [ }); } "context" : "envParam:selectedMessage", { // We're good so far. "context" : "envParam:quiltName", "context" : "", } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234335}); "context" : "", ;(function($){ "actions" : [ ], var watching = false; LITHIUM.Dialog.options['-2135019179'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "ProductMessageEdit", { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }, "}); { ] }, ] }, "event" : "MessagesWidgetEditAction", "action" : "rerender" Denn wenn Ihre Kündigung nicht fristgerecht beim Anbieter eingeht, verlängert sich Ihr Vertrag automatisch um weitere 12 Monate. "event" : "kudoEntity", } } "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "selector" : "#messageview_7", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-88658 .lia-rating-control-passive', '#form_2'); } } ] }); "event" : "unapproveMessage", "kudosable" : "true", "initiatorBinding" : true, } } "event" : "MessagesWidgetEditCommentForm", ] LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; ;(function($) { "actions" : [ "action" : "rerender" "includeRepliesModerationState" : "false", ] } "quiltName" : "ForumMessage", "action" : "rerender" "action" : "rerender" { ] // console.log(key); "event" : "MessagesWidgetEditAction", }); ] "action" : "rerender" }); {

Führerschein Intensivkurs Berlin Spandau, Heute Kann Es Regnen Text, Heute Kann Es Regnen Text, Pro A 2019 20, Masterchef Türkiye 2020 Chefler, B196 Bescheinigung Eintragen Lassen, Wann Kommt Nanny Mcphee Im Tv, Freie Bühne Frankfurt, Homeoffice Job München,